Placeholder image of a protein
Icon representing a puzzle

2601: Electron Density Reconstruction 115

Closed since 11 months ago

Novice Overall Prediction Electron Density

Summary

Created
April 09, 2025
Expires
Max points
100
Description

The structure of this protein and bound DNA has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
TGTTTTTGAGAAGA ATCTTCTCAAAAAC GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 19,917
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 56 pts. 19,909
  3. Avatar for Go Science 3. Go Science 29 pts. 19,872
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 14 pts. 19,872
  5. Avatar for Gargleblasters 5. Gargleblasters 6 pts. 19,842
  6. Avatar for Marvin's bunch 6. Marvin's bunch 2 pts. 19,805
  7. Avatar for Australia 7. Australia 1 pt. 19,780
  8. Avatar for Contenders 8. Contenders 1 pt. 19,776
  9. Avatar for VeFold 9. VeFold 1 pt. 19,774
  10. Avatar for Intellectual decay of Brazil (IDEB) 10. Intellectual decay of Brazil (IDEB) 1 pt. 14,941
  1. Avatar for vs 21. vs Lv 1 19 pts. 19,758
  2. Avatar for zeroblue 22. zeroblue Lv 1 17 pts. 19,756
  3. Avatar for alcor29 23. alcor29 Lv 1 16 pts. 19,745
  4. Avatar for Dr.Sillem 24. Dr.Sillem Lv 1 14 pts. 19,738
  5. Avatar for jamiexq 25. jamiexq Lv 1 13 pts. 19,728
  6. Avatar for g_b 26. g_b Lv 1 11 pts. 19,717
  7. Avatar for LadyCrazy 27. LadyCrazy Lv 1 10 pts. 19,708
  8. Avatar for NinjaGreg 28. NinjaGreg Lv 1 9 pts. 19,702
  9. Avatar for JuliaBCollet 29. JuliaBCollet Lv 1 8 pts. 19,700
  10. Avatar for manu8170 30. manu8170 Lv 1 7 pts. 19,678

Comments