Icon representing a puzzle

2598: Revisiting Puzzle 114: Black Mamba

Closed since 11 months ago

Novice Overall Prediction

Summary


Created
April 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for CHEM1210/1020 TTU 11. CHEM1210/1020 TTU 1 pt. 9,152
  2. Avatar for OmHS 12. OmHS 1 pt. 6,348
  3. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,348

  1. Avatar for Joanna_H 21. Joanna_H Lv 1 23 pts. 11,019
  2. Avatar for toshiue 22. toshiue Lv 1 21 pts. 11,003
  3. Avatar for g_b 23. g_b Lv 1 19 pts. 10,980
  4. Avatar for JuliaBCollet 24. JuliaBCollet Lv 1 17 pts. 10,895
  5. Avatar for jamiexq 25. jamiexq Lv 1 16 pts. 10,759
  6. Avatar for SuperEnzyme 26. SuperEnzyme Lv 1 15 pts. 10,733
  7. Avatar for Crossed Sticks 27. Crossed Sticks Lv 1 13 pts. 10,733
  8. Avatar for amakedon 28. amakedon Lv 1 12 pts. 10,733
  9. Avatar for heather-1 29. heather-1 Lv 1 11 pts. 10,630
  10. Avatar for manu8170 30. manu8170 Lv 1 10 pts. 10,569

Comments