Icon representing a puzzle

2598: Revisiting Puzzle 114: Black Mamba

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
April 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for CHEM1210/1020 TTU 11. CHEM1210/1020 TTU 1 pt. 9,152
  2. Avatar for OmHS 12. OmHS 1 pt. 6,348
  3. Avatar for Intellectual decay of Brazil (IDEB) 13. Intellectual decay of Brazil (IDEB) 1 pt. 6,348
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,348
  1. Avatar for AlphaFold2 31. AlphaFold2 Lv 1 9 pts. 10,498
  2. Avatar for Apothecary1815 32. Apothecary1815 Lv 1 8 pts. 10,454
  3. Avatar for BarrySampson 33. BarrySampson Lv 1 7 pts. 10,405
  4. Avatar for abiogenesis 34. abiogenesis Lv 1 7 pts. 10,248
  5. Avatar for Dr.Sillem 35. Dr.Sillem Lv 1 6 pts. 10,233
  6. Avatar for badgoes 36. badgoes Lv 1 5 pts. 10,182
  7. Avatar for Hellcat6 37. Hellcat6 Lv 1 5 pts. 10,139
  8. Avatar for zbp 38. zbp Lv 1 4 pts. 10,113
  9. Avatar for Larini 39. Larini Lv 1 4 pts. 10,108
  10. Avatar for Merf 40. Merf Lv 1 3 pts. 10,079

Comments