Icon representing a puzzle

2598: Revisiting Puzzle 114: Black Mamba

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
April 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for CHEM1210/1020 TTU 11. CHEM1210/1020 TTU 1 pt. 9,152
  2. Avatar for OmHS 12. OmHS 1 pt. 6,348
  3. Avatar for Intellectual decay of Brazil (IDEB) 13. Intellectual decay of Brazil (IDEB) 1 pt. 6,348
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,348
  1. Avatar for ppp6 51. ppp6 Lv 1 1 pt. 9,707
  2. Avatar for borattt 52. borattt Lv 1 1 pt. 9,692
  3. Avatar for CJen 53. CJen Lv 1 1 pt. 9,679
  4. Avatar for Mohoernchen 54. Mohoernchen Lv 1 1 pt. 9,664
  5. Avatar for DScott 55. DScott Lv 1 1 pt. 9,642
  6. Avatar for rinze 56. rinze Lv 1 1 pt. 9,369
  7. Avatar for Superphosphate 57. Superphosphate Lv 1 1 pt. 9,361
  8. Avatar for Fasodankfds 58. Fasodankfds Lv 1 1 pt. 9,289
  9. Avatar for Savas 59. Savas Lv 1 1 pt. 9,278
  10. Avatar for Anfinsen_slept_here 60. Anfinsen_slept_here Lv 1 1 pt. 9,229

Comments