Icon representing a puzzle

2598: Revisiting Puzzle 114: Black Mamba

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
April 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,364
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,266
  3. Avatar for Australia 3. Australia 44 pts. 11,154
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 11,110
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 11,097
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 11,075
  7. Avatar for Contenders 7. Contenders 5 pts. 11,046
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 11,019
  9. Avatar for VeFold 9. VeFold 1 pt. 10,895
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 9,278
  1. Avatar for jausmh 11. jausmh Lv 1 50 pts. 11,110
  2. Avatar for akaaka 12. akaaka Lv 1 47 pts. 11,109
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 43 pts. 11,105
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 40 pts. 11,103
  5. Avatar for meatexplosion 15. meatexplosion Lv 1 37 pts. 11,098
  6. Avatar for nicobul 16. nicobul Lv 1 34 pts. 11,097
  7. Avatar for WBarme1234 17. WBarme1234 Lv 1 32 pts. 11,075
  8. Avatar for Punzi Baker 3 18. Punzi Baker 3 Lv 1 29 pts. 11,056
  9. Avatar for BootsMcGraw 19. BootsMcGraw Lv 1 27 pts. 11,046
  10. Avatar for orily1337 20. orily1337 Lv 1 25 pts. 11,034

Comments