Icon representing a puzzle

2598: Revisiting Puzzle 114: Black Mamba

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Go Science 100 pts. 11,364
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,266
  3. Avatar for Australia 3. Australia 44 pts. 11,154
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 11,110
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 11,097
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 11,075
  7. Avatar for Contenders 7. Contenders 5 pts. 11,046
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 11,019
  9. Avatar for VeFold 9. VeFold 1 pt. 10,895
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 9,278

  1. Avatar for CAN1958 41. CAN1958 Lv 1 3 pts. 10,079
  2. Avatar for pizpot 42. pizpot Lv 1 3 pts. 9,891
  3. Avatar for kitsoune 43. kitsoune Lv 1 2 pts. 9,855
  4. Avatar for DH160 44. DH160 Lv 1 2 pts. 9,841
  5. Avatar for Osiris 45. Osiris Lv 1 2 pts. 9,785
  6. Avatar for prkfour 46. prkfour Lv 1 2 pts. 9,775
  7. Avatar for LHOr 47. LHOr Lv 1 2 pts. 9,769
  8. Avatar for Trajan464 48. Trajan464 Lv 1 1 pt. 9,730
  9. Avatar for carxo 49. carxo Lv 1 1 pt. 9,718
  10. Avatar for Vinara 50. Vinara Lv 1 1 pt. 9,717

Comments