Icon representing a puzzle

2598: Revisiting Puzzle 114: Black Mamba

Closed since 11 months ago

Novice Overall Prediction

Summary


Created
April 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Go Science 100 pts. 11,364
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,266
  3. Avatar for Australia 3. Australia 44 pts. 11,154
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 11,110
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 11,097
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 11,075
  7. Avatar for Contenders 7. Contenders 5 pts. 11,046
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 11,019
  9. Avatar for VeFold 9. VeFold 1 pt. 10,895
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 9,278

  1. Avatar for efull 61. efull Lv 1 1 pt. 9,216
  2. Avatar for Copt33 62. Copt33 Lv 1 1 pt. 9,177
  3. Avatar for parkercimon 64. parkercimon Lv 1 1 pt. 9,135
  4. Avatar for Swapper242 65. Swapper242 Lv 1 1 pt. 9,116
  5. Avatar for furi0us 66. furi0us Lv 1 1 pt. 9,103
  6. Avatar for Accella 67. Accella Lv 1 1 pt. 9,085
  7. Avatar for georgesfrem 68. georgesfrem Lv 1 1 pt. 8,804
  8. Avatar for XJS 70. XJS Lv 1 1 pt. 8,461

Comments