Icon representing a puzzle

2600: Revisiting Puzzle 115: Exocyst

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
April 23, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,194
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 11,162
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 11,056
  4. Avatar for Australia 4. Australia 24 pts. 10,991
  5. Avatar for Contenders 5. Contenders 14 pts. 10,970
  6. Avatar for VeFold 6. VeFold 7 pts. 10,932
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 10,927
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 10,846
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,760
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,686
  1. Avatar for Punzi Baker 3 11. Punzi Baker 3 Lv 1 52 pts. 11,079
  2. Avatar for nicobul 12. nicobul Lv 1 48 pts. 11,056
  3. Avatar for vs 13. vs Lv 1 45 pts. 11,028
  4. Avatar for AlkiP0Ps 14. AlkiP0Ps Lv 1 42 pts. 10,991
  5. Avatar for MicElephant 15. MicElephant Lv 1 39 pts. 10,970
  6. Avatar for BarrySampson 16. BarrySampson Lv 1 36 pts. 10,932
  7. Avatar for JuliaBCollet 17. JuliaBCollet Lv 1 33 pts. 10,929
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 31 pts. 10,927
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 28 pts. 10,916
  10. Avatar for BootsMcGraw 20. BootsMcGraw Lv 1 26 pts. 10,907

Comments