Icon representing a puzzle

2600: Revisiting Puzzle 115: Exocyst

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
April 23, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,194
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 11,162
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 11,056
  4. Avatar for Australia 4. Australia 24 pts. 10,991
  5. Avatar for Contenders 5. Contenders 14 pts. 10,970
  6. Avatar for VeFold 6. VeFold 7 pts. 10,932
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 10,927
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 10,846
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,760
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,686
  1. Avatar for g_b 21. g_b Lv 1 24 pts. 10,905
  2. Avatar for alcor29 22. alcor29 Lv 1 22 pts. 10,890
  3. Avatar for Joanna_H 23. Joanna_H Lv 1 21 pts. 10,846
  4. Avatar for NinjaGreg 24. NinjaGreg Lv 1 19 pts. 10,823
  5. Avatar for orily1337 25. orily1337 Lv 1 17 pts. 10,760
  6. Avatar for Anfinsen_slept_here 26. Anfinsen_slept_here Lv 1 16 pts. 10,728
  7. Avatar for meatexplosion 27. meatexplosion Lv 1 15 pts. 10,725
  8. Avatar for spmm 28. spmm Lv 1 13 pts. 10,686
  9. Avatar for drumpeter18yrs9yrs 29. drumpeter18yrs9yrs Lv 1 12 pts. 10,675
  10. Avatar for amakedon 30. amakedon Lv 1 11 pts. 10,661

Comments