Icon representing a puzzle

2600: Revisiting Puzzle 115: Exocyst

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
April 23, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,194
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 11,162
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 11,056
  4. Avatar for Australia 4. Australia 24 pts. 10,991
  5. Avatar for Contenders 5. Contenders 14 pts. 10,970
  6. Avatar for VeFold 6. VeFold 7 pts. 10,932
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 10,927
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 10,846
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,760
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,686
  1. Avatar for jamiexq 41. jamiexq Lv 1 4 pts. 10,460
  2. Avatar for rosie4loop 42. rosie4loop Lv 1 3 pts. 10,425
  3. Avatar for carsonfb 43. carsonfb Lv 1 3 pts. 10,360
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 3 pts. 10,328
  5. Avatar for AlphaFold2 45. AlphaFold2 Lv 1 2 pts. 10,289
  6. Avatar for Osiris 46. Osiris Lv 1 2 pts. 10,287
  7. Avatar for Dr.Sillem 47. Dr.Sillem Lv 1 2 pts. 10,278
  8. Avatar for Larini 48. Larini Lv 1 2 pts. 10,266
  9. Avatar for Crossed Sticks 49. Crossed Sticks Lv 1 2 pts. 10,253
  10. Avatar for Trajan464 50. Trajan464 Lv 1 1 pt. 10,146

Comments