Icon representing a puzzle

2600: Revisiting Puzzle 115: Exocyst

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
April 23, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,194
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 11,162
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 11,056
  4. Avatar for Australia 4. Australia 24 pts. 10,991
  5. Avatar for Contenders 5. Contenders 14 pts. 10,970
  6. Avatar for VeFold 6. VeFold 7 pts. 10,932
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 10,927
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 10,846
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,760
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,686
  1. Avatar for spryw 71. spryw Lv 1 1 pt. 9,343
  2. Avatar for bestfolder29zb 72. bestfolder29zb Lv 1 1 pt. 9,330
  3. Avatar for Swapper242 73. Swapper242 Lv 1 1 pt. 9,310
  4. Avatar for furi0us 74. furi0us Lv 1 1 pt. 9,261
  5. Avatar for chelseahexxx 75. chelseahexxx Lv 1 1 pt. 9,168
  6. Avatar for doctaven 76. doctaven Lv 1 1 pt. 9,149
  7. Avatar for Rat_Man 77. Rat_Man Lv 1 1 pt. 9,120
  8. Avatar for Sciren 78. Sciren Lv 1 1 pt. 5,843
  9. Avatar for Josephiroth 79. Josephiroth Lv 1 1 pt. 5,843
  10. Avatar for Unearthtw 80. Unearthtw Lv 1 1 pt. 5,843

Comments