Icon representing a puzzle

2600: Revisiting Puzzle 115: Exocyst

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
April 23, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,194
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 11,162
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 41 pts. 11,056
  4. Avatar for Australia 4. Australia 24 pts. 10,991
  5. Avatar for Contenders 5. Contenders 14 pts. 10,970
  6. Avatar for VeFold 6. VeFold 7 pts. 10,932
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 10,927
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 10,846
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,760
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,686
  1. Avatar for RWoodcock 61. RWoodcock Lv 1 1 pt. 9,651
  2. Avatar for rinze 62. rinze Lv 1 1 pt. 9,618
  3. Avatar for Anvani_09118 63. Anvani_09118 Lv 1 1 pt. 9,546
  4. Avatar for corvidcapsule 64. corvidcapsule Lv 1 1 pt. 9,492
  5. Avatar for Arthemian 65. Arthemian Lv 1 1 pt. 9,488
  6. Avatar for efull 66. efull Lv 1 1 pt. 9,454
  7. Avatar for froschi2 67. froschi2 Lv 1 1 pt. 9,446
  8. Avatar for lewjabhiahgklankndkannvdz 68. lewjabhiahgklankndkannvdz Lv 1 1 pt. 9,439
  9. Avatar for melonogaster 69. melonogaster Lv 1 1 pt. 9,428
  10. Avatar for prkfour 70. prkfour Lv 1 1 pt. 9,344

Comments