Icon representing a puzzle

2609: Revisiting Puzzle 125: Ice Binding Protein

Closed since 10 months ago

Novice Overall Prediction

Summary

Created
May 14, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,190
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,714
  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 23 pts. 10,069
  2. Avatar for alcor29 22. alcor29 Lv 1 21 pts. 10,069
  3. Avatar for Galaxie 23. Galaxie Lv 1 20 pts. 10,051
  4. Avatar for zxspectrum 24. zxspectrum Lv 1 18 pts. 10,046
  5. Avatar for TheGUmmer 25. TheGUmmer Lv 1 16 pts. 10,039
  6. Avatar for LHOr 26. LHOr Lv 1 15 pts. 10,021
  7. Avatar for orily1337 27. orily1337 Lv 1 14 pts. 10,014
  8. Avatar for jamiexq 28. jamiexq Lv 1 12 pts. 10,008
  9. Avatar for rosie4loop 29. rosie4loop Lv 1 11 pts. 9,972
  10. Avatar for Aubade01 30. Aubade01 Lv 1 10 pts. 9,969

Comments