Icon representing a puzzle

2609: Revisiting Puzzle 125: Ice Binding Protein

Closed since 10 months ago

Novice Overall Prediction

Summary

Created
May 14, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,201
  2. Avatar for Go Science 2. Go Science 63 pts. 10,195
  3. Avatar for Contenders 3. Contenders 37 pts. 10,157
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,148
  5. Avatar for Australia 5. Australia 11 pts. 10,119
  6. Avatar for Gargleblasters 6. Gargleblasters 5 pts. 10,112
  7. Avatar for VeFold 7. VeFold 2 pts. 10,109
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,069
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,039
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 10,014
  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 23 pts. 10,069
  2. Avatar for alcor29 22. alcor29 Lv 1 21 pts. 10,069
  3. Avatar for Galaxie 23. Galaxie Lv 1 20 pts. 10,051
  4. Avatar for zxspectrum 24. zxspectrum Lv 1 18 pts. 10,046
  5. Avatar for TheGUmmer 25. TheGUmmer Lv 1 16 pts. 10,039
  6. Avatar for LHOr 26. LHOr Lv 1 15 pts. 10,021
  7. Avatar for orily1337 27. orily1337 Lv 1 14 pts. 10,014
  8. Avatar for jamiexq 28. jamiexq Lv 1 12 pts. 10,008
  9. Avatar for rosie4loop 29. rosie4loop Lv 1 11 pts. 9,972
  10. Avatar for Aubade01 30. Aubade01 Lv 1 10 pts. 9,969

Comments