Icon representing a puzzle

2609: Revisiting Puzzle 125: Ice Binding Protein

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
May 14, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,190
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,714
  1. Avatar for JuliaBCollet 31. JuliaBCollet Lv 1 9 pts. 9,966
  2. Avatar for RichGuilmain 32. RichGuilmain Lv 1 8 pts. 9,957
  3. Avatar for Apothecary1815 33. Apothecary1815 Lv 1 8 pts. 9,929
  4. Avatar for hada 34. hada Lv 1 7 pts. 9,886
  5. Avatar for Dr.Sillem 35. Dr.Sillem Lv 1 6 pts. 9,880
  6. Avatar for badgoes 36. badgoes Lv 1 6 pts. 9,871
  7. Avatar for Larini 37. Larini Lv 1 5 pts. 9,839
  8. Avatar for abiogenesis 38. abiogenesis Lv 1 5 pts. 9,828
  9. Avatar for Anfinsen_slept_here 39. Anfinsen_slept_here Lv 1 4 pts. 9,800
  10. Avatar for heather-1 40. heather-1 Lv 1 4 pts. 9,787

Comments