Icon representing a puzzle

2609: Revisiting Puzzle 125: Ice Binding Protein

Closed since 10 months ago

Novice Overall Prediction

Summary


Created
May 14, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,201
  2. Avatar for Go Science 2. Go Science 63 pts. 10,195
  3. Avatar for Contenders 3. Contenders 37 pts. 10,157
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,148
  5. Avatar for Australia 5. Australia 11 pts. 10,119
  6. Avatar for Gargleblasters 6. Gargleblasters 5 pts. 10,112
  7. Avatar for VeFold 7. VeFold 2 pts. 10,109
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,069
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,039
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 10,014

  1. Avatar for JuliaBCollet 31. JuliaBCollet Lv 1 9 pts. 9,966
  2. Avatar for RichGuilmain 32. RichGuilmain Lv 1 8 pts. 9,957
  3. Avatar for Apothecary1815 33. Apothecary1815 Lv 1 8 pts. 9,929
  4. Avatar for hada 34. hada Lv 1 7 pts. 9,886
  5. Avatar for Dr.Sillem 35. Dr.Sillem Lv 1 6 pts. 9,880
  6. Avatar for badgoes 36. badgoes Lv 1 6 pts. 9,871
  7. Avatar for Larini 37. Larini Lv 1 5 pts. 9,839
  8. Avatar for abiogenesis 38. abiogenesis Lv 1 5 pts. 9,828
  9. Avatar for heather-1 40. heather-1 Lv 1 4 pts. 9,787

Comments