Icon representing a puzzle

2609: Revisiting Puzzle 125: Ice Binding Protein

Closed since 10 months ago

Novice Overall Prediction

Summary

Created
May 14, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,190
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,714
  1. Avatar for ProfVince 41. ProfVince Lv 1 3 pts. 9,782
  2. Avatar for hookedwarm 42. hookedwarm Lv 1 3 pts. 9,781
  3. Avatar for Tian00 43. Tian00 Lv 1 3 pts. 9,772
  4. Avatar for nicobul 44. nicobul Lv 1 2 pts. 9,764
  5. Avatar for Osiris 45. Osiris Lv 1 2 pts. 9,746
  6. Avatar for pfirth 46. pfirth Lv 1 2 pts. 9,733
  7. Avatar for Th1sN@me!sN0tAPun 47. Th1sN@me!sN0tAPun Lv 1 2 pts. 9,714
  8. Avatar for jausmh 48. jausmh Lv 1 1 pt. 9,687
  9. Avatar for pizpot 49. pizpot Lv 1 1 pt. 9,657
  10. Avatar for zbp 50. zbp Lv 1 1 pt. 9,553

Comments