Icon representing a puzzle

2609: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 14, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,201
  2. Avatar for Go Science 2. Go Science 63 pts. 10,195
  3. Avatar for Contenders 3. Contenders 37 pts. 10,157
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,148
  5. Avatar for Australia 5. Australia 11 pts. 10,119
  6. Avatar for Gargleblasters 6. Gargleblasters 5 pts. 10,112
  7. Avatar for VeFold 7. VeFold 2 pts. 10,109
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,069
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,039
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 10,014

  1. Avatar for ProfVince 41. ProfVince Lv 1 3 pts. 9,782
  2. Avatar for hookedwarm 42. hookedwarm Lv 1 3 pts. 9,781
  3. Avatar for Tian00 43. Tian00 Lv 1 3 pts. 9,772
  4. Avatar for nicobul 44. nicobul Lv 1 2 pts. 9,764
  5. Avatar for Osiris 45. Osiris Lv 1 2 pts. 9,746
  6. Avatar for pfirth 46. pfirth Lv 1 2 pts. 9,733
  7. Avatar for Th1sN@me!sN0tAPun 47. Th1sN@me!sN0tAPun Lv 1 2 pts. 9,714
  8. Avatar for jausmh 48. jausmh Lv 1 1 pt. 9,687
  9. Avatar for pizpot 49. pizpot Lv 1 1 pt. 9,657
  10. Avatar for zbp 50. zbp Lv 1 1 pt. 9,553

Comments