Icon representing a puzzle

2609: Revisiting Puzzle 125: Ice Binding Protein

Closed since 10 months ago

Novice Overall Prediction

Summary

Created
May 14, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,190
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,714
  1. Avatar for Shado165 71. Shado165 Lv 1 1 pt. 8,864
  2. Avatar for Swapper242 72. Swapper242 Lv 1 1 pt. 8,819
  3. Avatar for drumpeter18yrs9yrs 73. drumpeter18yrs9yrs Lv 1 1 pt. 8,810
  4. Avatar for furi0us 74. furi0us Lv 1 1 pt. 8,778
  5. Avatar for Deviek Verma 75. Deviek Verma Lv 1 1 pt. 8,714
  6. Avatar for Zivilyn 76. Zivilyn Lv 1 1 pt. 8,047
  7. Avatar for marc.gm 77. marc.gm Lv 1 1 pt. 6,866
  8. Avatar for Jonatas 78. Jonatas Lv 1 1 pt. 6,488
  9. Avatar for beta_helix 79. beta_helix Lv 1 1 pt. 6,488

Comments