Icon representing a puzzle

2609: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 14, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,201
  2. Avatar for Go Science 2. Go Science 63 pts. 10,195
  3. Avatar for Contenders 3. Contenders 37 pts. 10,157
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,148
  5. Avatar for Australia 5. Australia 11 pts. 10,119
  6. Avatar for Gargleblasters 6. Gargleblasters 5 pts. 10,112
  7. Avatar for VeFold 7. VeFold 2 pts. 10,109
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,069
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,039
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 10,014

  1. Avatar for Shado165 71. Shado165 Lv 1 1 pt. 8,864
  2. Avatar for Swapper242 72. Swapper242 Lv 1 1 pt. 8,819
  3. Avatar for furi0us 74. furi0us Lv 1 1 pt. 8,778
  4. Avatar for Deviek Verma 75. Deviek Verma Lv 1 1 pt. 8,714
  5. Avatar for Zivilyn 76. Zivilyn Lv 1 1 pt. 8,047
  6. Avatar for marc.gm 77. marc.gm Lv 1 1 pt. 6,866
  7. Avatar for Jonatas 78. Jonatas Lv 1 1 pt. 6,488
  8. Avatar for beta_helix 79. beta_helix Lv 1 1 pt. 6,488

Comments