Icon representing a puzzle

2615: Revisiting Puzzle 134: Rice

Closed since 10 months ago

Novice Overall Prediction

Summary


Created
May 28, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 9,174
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,786
  3. Avatar for Extraterrestrials 2.0 13. Extraterrestrials 2.0 1 pt. 8,679

  1. Avatar for SemperRabbit 11. SemperRabbit Lv 1 54 pts. 10,466
  2. Avatar for dcrwheeler 12. dcrwheeler Lv 1 51 pts. 10,458
  3. Avatar for MicElephant 13. MicElephant Lv 1 47 pts. 10,456
  4. Avatar for akaaka 14. akaaka Lv 1 44 pts. 10,444
  5. Avatar for BootsMcGraw 15. BootsMcGraw Lv 1 41 pts. 10,409
  6. Avatar for LHOr 16. LHOr Lv 1 38 pts. 10,361
  7. Avatar for g_b 17. g_b Lv 1 36 pts. 10,344
  8. Avatar for Joanna_H 18. Joanna_H Lv 1 33 pts. 10,341
  9. Avatar for WBarme1234 19. WBarme1234 Lv 1 31 pts. 10,333
  10. Avatar for Punzi Baker 3 20. Punzi Baker 3 Lv 1 29 pts. 10,308

Comments