Icon representing a puzzle

2618: Revisiting Puzzle 135: E. coli

Closed since 10 months ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
June 04, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 7,048
  1. Avatar for Idiotboy 71. Idiotboy Lv 1 1 pt. 7,395
  2. Avatar for rmoretti 72. rmoretti Lv 1 1 pt. 7,048
  3. Avatar for 01010011111 73. 01010011111 Lv 1 1 pt. 5,563
  4. Avatar for meme1333 74. meme1333 Lv 1 1 pt. 5,484
  5. Avatar for greentomato 75. greentomato Lv 1 1 pt. 5,351
  6. Avatar for Prussia 76. Prussia Lv 1 1 pt. 5,351

Comments