Icon representing a puzzle

2618: Revisiting Puzzle 135: E. coli

Closed since 9 months ago

Novice Overall Prediction

Summary

Created
June 04, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,915
  2. Avatar for Go Science 2. Go Science 60 pts. 9,875
  3. Avatar for Contenders 3. Contenders 33 pts. 9,723
  4. Avatar for Australia 4. Australia 17 pts. 9,702
  5. Avatar for VeFold 5. VeFold 8 pts. 9,613
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,537
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 9,477
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 9,454
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,431
  10. Avatar for Team China 10. Team China 1 pt. 7,416
  1. Avatar for Idiotboy 71. Idiotboy Lv 1 1 pt. 7,395
  2. Avatar for rmoretti 72. rmoretti Lv 1 1 pt. 7,048
  3. Avatar for 01010011111 73. 01010011111 Lv 1 1 pt. 5,563
  4. Avatar for meme1333 74. meme1333 Lv 1 1 pt. 5,484
  5. Avatar for Prussia 75. Prussia Lv 1 1 pt. 5,351
  6. Avatar for greentomato 76. greentomato Lv 1 1 pt. 5,351

Comments