Icon representing a puzzle

2618: Revisiting Puzzle 135: E. coli

Closed since 9 months ago

Novice Overall Prediction

Summary

Created
June 04, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,915
  2. Avatar for Go Science 2. Go Science 60 pts. 9,875
  3. Avatar for Contenders 3. Contenders 33 pts. 9,723
  4. Avatar for Australia 4. Australia 17 pts. 9,702
  5. Avatar for VeFold 5. VeFold 8 pts. 9,613
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,537
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 9,477
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 9,454
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,431
  10. Avatar for Team China 10. Team China 1 pt. 7,416
  1. Avatar for stomjoh 41. stomjoh Lv 1 3 pts. 9,231
  2. Avatar for manu8170 42. manu8170 Lv 1 2 pts. 9,224
  3. Avatar for ProfVince 43. ProfVince Lv 1 2 pts. 9,206
  4. Avatar for toshiue 44. toshiue Lv 1 2 pts. 9,203
  5. Avatar for abiogenesis 45. abiogenesis Lv 1 2 pts. 9,194
  6. Avatar for badgoes 46. badgoes Lv 1 2 pts. 9,177
  7. Avatar for jamiexq 47. jamiexq Lv 1 1 pt. 9,165
  8. Avatar for pizpot 48. pizpot Lv 1 1 pt. 9,132
  9. Avatar for hada 49. hada Lv 1 1 pt. 9,101
  10. Avatar for BlueCat74 50. BlueCat74 Lv 1 1 pt. 9,096

Comments