Icon representing a puzzle

2623: Revisiting Puzzle 137: Rosetta Decoy

Closed since 10 months ago

Novice Overall Prediction

Summary

Created
June 18, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Firesign 11. Firesign 1 pt. 9,640
  1. Avatar for Apothecary1815 41. Apothecary1815 Lv 1 2 pts. 10,978
  2. Avatar for manu8170 42. manu8170 Lv 1 2 pts. 10,951
  3. Avatar for pfirth 43. pfirth Lv 1 2 pts. 10,946
  4. Avatar for ProfVince 44. ProfVince Lv 1 2 pts. 10,941
  5. Avatar for haleyg 45. haleyg Lv 1 1 pt. 10,927
  6. Avatar for muffnerk 46. muffnerk Lv 1 1 pt. 10,902
  7. Avatar for Laudrup18 47. Laudrup18 Lv 1 1 pt. 10,890
  8. Avatar for zbp 48. zbp Lv 1 1 pt. 10,880
  9. Avatar for Trajan464 49. Trajan464 Lv 1 1 pt. 10,879
  10. Avatar for AlphaFold2 50. AlphaFold2 Lv 1 1 pt. 10,849

Comments