Icon representing a puzzle

2635: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since 8 months ago

Novice Overall Prediction

Summary

Created
July 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 10,870
  2. Avatar for Firesign 12. Firesign 1 pt. 8,561
  1. Avatar for nicobul 11. nicobul Lv 1 44 pts. 11,691
  2. Avatar for gmn 12. gmn Lv 1 41 pts. 11,665
  3. Avatar for MicElephant 13. MicElephant Lv 1 37 pts. 11,660
  4. Avatar for hookedwarm 14. hookedwarm Lv 1 34 pts. 11,638
  5. Avatar for g_b 15. g_b Lv 1 31 pts. 11,628
  6. Avatar for orily1337 16. orily1337 Lv 1 28 pts. 11,596
  7. Avatar for AlkiP0Ps 17. AlkiP0Ps Lv 1 25 pts. 11,588
  8. Avatar for Tehnologik1 18. Tehnologik1 Lv 1 23 pts. 11,586
  9. Avatar for SemperRabbit 19. SemperRabbit Lv 1 21 pts. 11,585
  10. Avatar for meatexplosion 20. meatexplosion Lv 1 19 pts. 11,509

Comments