Icon representing a puzzle

2647: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since 7 months ago

Novice Overall Prediction

Summary

Created
August 13, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.

Sequence
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,673
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 11,649
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 11,368
  4. Avatar for Contenders 4. Contenders 21 pts. 11,351
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 11 pts. 11,330
  6. Avatar for Australia 6. Australia 5 pts. 11,254
  7. Avatar for VeFold 7. VeFold 2 pts. 11,240
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 11,237
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 11,208
  10. Avatar for Team China 10. Team China 1 pt. 11,192
  1. Avatar for Dr.Sillem 31. Dr.Sillem Lv 1 6 pts. 11,133
  2. Avatar for zxspectrum 32. zxspectrum Lv 1 5 pts. 11,114
  3. Avatar for borattt 33. borattt Lv 1 5 pts. 11,088
  4. Avatar for Apothecary1815 34. Apothecary1815 Lv 1 4 pts. 11,086
  5. Avatar for heather-1 35. heather-1 Lv 1 4 pts. 11,022
  6. Avatar for jamiexq 36. jamiexq Lv 1 3 pts. 11,005
  7. Avatar for pfirth 37. pfirth Lv 1 3 pts. 10,976
  8. Avatar for Alistair69 38. Alistair69 Lv 1 2 pts. 10,961
  9. Avatar for Larini 39. Larini Lv 1 2 pts. 10,954
  10. Avatar for ProteinShake 40. ProteinShake Lv 1 2 pts. 10,912

Comments