Icon representing a puzzle

2647: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since 7 months ago

Novice Overall Prediction

Summary

Created
August 13, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.

Sequence
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,673
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 11,649
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 11,368
  4. Avatar for Contenders 4. Contenders 21 pts. 11,351
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 11 pts. 11,330
  6. Avatar for Australia 6. Australia 5 pts. 11,254
  7. Avatar for VeFold 7. VeFold 2 pts. 11,240
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 11,237
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 11,208
  10. Avatar for Team China 10. Team China 1 pt. 11,192
  1. Avatar for DScott 51. DScott Lv 1 1 pt. 10,583
  2. Avatar for carxo 52. carxo Lv 1 1 pt. 10,564
  3. Avatar for Merf 53. Merf Lv 1 1 pt. 10,519
  4. Avatar for Brenton_P 54. Brenton_P Lv 1 1 pt. 10,495
  5. Avatar for Hellcat6 55. Hellcat6 Lv 1 1 pt. 10,432
  6. Avatar for arotomic 56. arotomic Lv 1 1 pt. 10,414
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 10,363
  8. Avatar for Atharvax0106 58. Atharvax0106 Lv 1 1 pt. 10,301
  9. Avatar for dabster 59. dabster Lv 1 1 pt. 10,229
  10. Avatar for thewholeblahthing 60. thewholeblahthing Lv 1 1 pt. 10,215

Comments