Icon representing a puzzle

2647: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since 7 months ago

Novice Overall Prediction

Summary


Created
August 13, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.

Sequence
AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Go Science 100 pts. 11,673
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 11,649
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 11,368
  4. Avatar for Contenders 4. Contenders 21 pts. 11,351
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 11 pts. 11,330
  6. Avatar for Australia 6. Australia 5 pts. 11,254
  7. Avatar for VeFold 7. VeFold 2 pts. 11,240
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 11,237
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 11,208
  10. Avatar for Team China 10. Team China 1 pt. 11,192

  1. Avatar for hada 41. hada Lv 1 2 pts. 10,906
  2. Avatar for BeatriceGrace 42. BeatriceGrace Lv 1 1 pt. 10,866
  3. Avatar for zbp 43. zbp Lv 1 1 pt. 10,817
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 1 pt. 10,812
  5. Avatar for stomjoh 45. stomjoh Lv 1 1 pt. 10,811
  6. Avatar for Trajan464 46. Trajan464 Lv 1 1 pt. 10,793
  7. Avatar for orily1337 47. orily1337 Lv 1 1 pt. 10,776
  8. Avatar for Savas 48. Savas Lv 1 1 pt. 10,634
  9. Avatar for Mohoernchen 49. Mohoernchen Lv 1 1 pt. 10,605
  10. Avatar for RWoodcock 50. RWoodcock Lv 1 1 pt. 10,583

Comments