Placeholder image of a protein
Icon representing a puzzle

2654: Electron Density Reconstruction 133

Closed since 9 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
August 18, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 40,594
  2. Avatar for Go Science 2. Go Science 68 pts. 40,538
  3. Avatar for Contenders 3. Contenders 44 pts. 40,482
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 40,471
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 40,200
  6. Avatar for Australia 6. Australia 9 pts. 40,181
  7. Avatar for Team China 7. Team China 5 pts. 39,771
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 39,760
  9. Avatar for VeFold 9. VeFold 1 pt. 39,540
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 39,417

  1. Avatar for Idiotboy 31. Idiotboy Lv 1 6 pts. 39,256
  2. Avatar for zxspectrum 32. zxspectrum Lv 1 6 pts. 39,103
  3. Avatar for Joanna_H 33. Joanna_H Lv 1 5 pts. 39,092
  4. Avatar for AlphaFold2 34. AlphaFold2 Lv 1 4 pts. 38,994
  5. Avatar for Dr.Sillem 35. Dr.Sillem Lv 1 4 pts. 38,751
  6. Avatar for hada 36. hada Lv 1 3 pts. 38,736
  7. Avatar for manu8170 37. manu8170 Lv 1 3 pts. 38,711
  8. Avatar for Trajan464 38. Trajan464 Lv 1 3 pts. 38,489
  9. Avatar for Alistair69 39. Alistair69 Lv 1 2 pts. 38,372
  10. Avatar for drumpeter18yrs9yrs 40. drumpeter18yrs9yrs Lv 1 2 pts. 38,290

Comments