Placeholder image of a protein
Icon representing a puzzle

2654: Electron Density Reconstruction 133

Closed since 9 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
August 18, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 40,594
  2. Avatar for Go Science 2. Go Science 68 pts. 40,538
  3. Avatar for Contenders 3. Contenders 44 pts. 40,482
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 40,471
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 40,200
  6. Avatar for Australia 6. Australia 9 pts. 40,181
  7. Avatar for Team China 7. Team China 5 pts. 39,771
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 39,760
  9. Avatar for VeFold 9. VeFold 1 pt. 39,540
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 39,417

  1. Avatar for DScott 51. DScott Lv 1 1 pt. 36,301
  2. Avatar for abiogenesis 52. abiogenesis Lv 1 1 pt. 36,289
  3. Avatar for carxo 53. carxo Lv 1 1 pt. 36,212
  4. Avatar for prkfour 54. prkfour Lv 1 1 pt. 36,145
  5. Avatar for Merf 55. Merf Lv 1 1 pt. 36,099
  6. Avatar for rinze 56. rinze Lv 1 1 pt. 36,007
  7. Avatar for kawaix 57. kawaix Lv 1 1 pt. 35,978
  8. Avatar for j_oda 58. j_oda Lv 1 1 pt. 35,941
  9. Avatar for fikret 59. fikret Lv 1 1 pt. 35,885
  10. Avatar for RWoodcock 60. RWoodcock Lv 1 1 pt. 35,831

Comments