Placeholder image of a protein
Icon representing a puzzle

2654: Electron Density Reconstruction 133

Closed since 9 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
August 18, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MDTEKLMKAGEIAKKVREKAIKLARPGMLLLELAESIEKMIMELGGKPAFPVNLSINEIAAHYTPYKGDTTVLKEGDYLKIDVGVHIDGFIADTAVTVRVGMEEDELMEAAKEALNAAISVARAGVEIKELGKAIENEIRKRGFKPIVNLSGHKIERYKLHAGISIPNIYRPHDNYVLKEGDVFAIEPFATIGAGQVIEVPPTLIYMYVRDVPVRVAQARFLLAKIKREYGTLPFAYRWLQNDMPEGQLKLALKTLEKAGAIYGYPVLKEIRNGIVAQFEHTIIVEKDSVIVTTE

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 40,594
  2. Avatar for Go Science 2. Go Science 68 pts. 40,538
  3. Avatar for Contenders 3. Contenders 44 pts. 40,482
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 40,471
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 40,200
  6. Avatar for Australia 6. Australia 9 pts. 40,181
  7. Avatar for Team China 7. Team China 5 pts. 39,771
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 39,760
  9. Avatar for VeFold 9. VeFold 1 pt. 39,540
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 39,417

  1. Avatar for kwiley10 61. kwiley10 Lv 1 1 pt. 35,827
  2. Avatar for Tkzw-shieu 62. Tkzw-shieu Lv 1 1 pt. 35,821
  3. Avatar for antibot215 63. antibot215 Lv 1 1 pt. 35,623
  4. Avatar for Bletchley Park 64. Bletchley Park Lv 1 1 pt. 35,612
  5. Avatar for furi0us 65. furi0us Lv 1 1 pt. 34,627
  6. Avatar for fact0rial 66. fact0rial Lv 1 1 pt. 34,137
  7. Avatar for JellyfishOliPlays 67. JellyfishOliPlays Lv 1 1 pt. 32,019
  8. Avatar for Russbear 68. Russbear Lv 1 1 pt. 31,515
  9. Avatar for Donquitonqui 69. Donquitonqui Lv 1 1 pt. 9,085
  10. Avatar for Nikhil 70. Nikhil Lv 1 1 pt. 9,028

Comments