Icon representing a puzzle

2671: Revisiting Puzzle 52: Bacteria Energy

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
October 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 10,949
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,326
  3. Avatar for Brain Nourishment 13. Brain Nourishment 1 pt. 10,139
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 9,878
  5. Avatar for BIOL2020AB Fall2025 15. BIOL2020AB Fall2025 1 pt. 1,913
  1. Avatar for hada 31. hada Lv 1 10 pts. 10,879
  2. Avatar for AlphaFold2 32. AlphaFold2 Lv 1 9 pts. 10,878
  3. Avatar for jausmh 33. jausmh Lv 1 9 pts. 10,837
  4. Avatar for heather-1 34. heather-1 Lv 1 8 pts. 10,801
  5. Avatar for SileNTViP 35. SileNTViP Lv 1 7 pts. 10,790
  6. Avatar for meatexplosion 36. meatexplosion Lv 1 6 pts. 10,783
  7. Avatar for BarrySampson 37. BarrySampson Lv 1 6 pts. 10,750
  8. Avatar for rosie4loop 38. rosie4loop Lv 1 5 pts. 10,713
  9. Avatar for ProfVince 39. ProfVince Lv 1 5 pts. 10,669
  10. Avatar for Alistair69 40. Alistair69 Lv 1 4 pts. 10,659

Comments