Icon representing a puzzle

2671: Revisiting Puzzle 52: Bacteria Energy

Closed since 5 months ago

Novice Overall Prediction

Summary

Created
October 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,687
  2. Avatar for Go Science 2. Go Science 70 pts. 11,647
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 47 pts. 11,579
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 11,418
  5. Avatar for Void Crushers 5. Void Crushers 19 pts. 11,339
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 11,333
  7. Avatar for Contenders 7. Contenders 7 pts. 11,282
  8. Avatar for Australia 8. Australia 4 pts. 11,269
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,046
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 10,974
  1. Avatar for hada 31. hada Lv 1 10 pts. 10,879
  2. Avatar for AlphaFold2 32. AlphaFold2 Lv 1 9 pts. 10,878
  3. Avatar for jausmh 33. jausmh Lv 1 9 pts. 10,837
  4. Avatar for heather-1 34. heather-1 Lv 1 8 pts. 10,801
  5. Avatar for SileNTViP 35. SileNTViP Lv 1 7 pts. 10,790
  6. Avatar for meatexplosion 36. meatexplosion Lv 1 6 pts. 10,783
  7. Avatar for BarrySampson 37. BarrySampson Lv 1 6 pts. 10,750
  8. Avatar for rosie4loop 38. rosie4loop Lv 1 5 pts. 10,713
  9. Avatar for ProfVince 39. ProfVince Lv 1 5 pts. 10,669
  10. Avatar for Alistair69 40. Alistair69 Lv 1 4 pts. 10,659

Comments