Icon representing a puzzle

2671: Revisiting Puzzle 52: Bacteria Energy

Closed since 6 months ago

Novice Overall Prediction

Summary

Created
October 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 10,949
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 10,326
  3. Avatar for Brain Nourishment 13. Brain Nourishment 1 pt. 10,139
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 9,878
  5. Avatar for BIOL2020AB Fall2025 15. BIOL2020AB Fall2025 1 pt. 1,913
  1. Avatar for Joanna_H 41. Joanna_H Lv 1 4 pts. 10,598
  2. Avatar for carxo 42. carxo Lv 1 3 pts. 10,585
  3. Avatar for matt61ger 43. matt61ger Lv 1 3 pts. 10,582
  4. Avatar for jamiexq 44. jamiexq Lv 1 3 pts. 10,567
  5. Avatar for gmn 45. gmn Lv 1 2 pts. 10,562
  6. Avatar for Trajan464 46. Trajan464 Lv 1 2 pts. 10,383
  7. Avatar for pfirth 47. pfirth Lv 1 2 pts. 10,361
  8. Avatar for chrisb41 48. chrisb41 Lv 1 2 pts. 10,355
  9. Avatar for abiogenesis 49. abiogenesis Lv 1 2 pts. 10,332
  10. Avatar for Savas 50. Savas Lv 1 1 pt. 10,326

Comments