Icon representing a puzzle

2671: Revisiting Puzzle 52: Bacteria Energy

Closed since 5 months ago

Novice Overall Prediction

Summary


Created
October 08, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,687
  2. Avatar for Go Science 2. Go Science 70 pts. 11,647
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 47 pts. 11,579
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 11,418
  5. Avatar for Void Crushers 5. Void Crushers 19 pts. 11,339
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 11,333
  7. Avatar for Contenders 7. Contenders 7 pts. 11,282
  8. Avatar for Australia 8. Australia 4 pts. 11,269
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,046
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 10,974

  1. Avatar for Joanna_H 41. Joanna_H Lv 1 4 pts. 10,598
  2. Avatar for carxo 42. carxo Lv 1 3 pts. 10,585
  3. Avatar for matt61ger 43. matt61ger Lv 1 3 pts. 10,582
  4. Avatar for jamiexq 44. jamiexq Lv 1 3 pts. 10,567
  5. Avatar for gmn 45. gmn Lv 1 2 pts. 10,562
  6. Avatar for Trajan464 46. Trajan464 Lv 1 2 pts. 10,383
  7. Avatar for pfirth 47. pfirth Lv 1 2 pts. 10,361
  8. Avatar for chrisb41 48. chrisb41 Lv 1 2 pts. 10,355
  9. Avatar for abiogenesis 49. abiogenesis Lv 1 2 pts. 10,332
  10. Avatar for Savas 50. Savas Lv 1 1 pt. 10,326

Comments