Icon representing a puzzle

2686: Revisiting Puzzle 59: TCR Binding Protein

Closed since 4 months ago

Novice Overall Prediction

Summary

Created
November 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,384
  2. Avatar for Team China 12. Team China 1 pt. 9,054
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,527
  4. Avatar for Bioqué? 14. Bioqué? 1 pt. 8,513
  1. Avatar for pfirth 31. pfirth Lv 1 8 pts. 9,734
  2. Avatar for abiogenesis 32. abiogenesis Lv 1 7 pts. 9,710
  3. Avatar for orily1337 33. orily1337 Lv 1 6 pts. 9,693
  4. Avatar for carxo 34. carxo Lv 1 5 pts. 9,591
  5. Avatar for Moolanie 35. Moolanie Lv 1 5 pts. 9,578
  6. Avatar for Fasodankfds 36. Fasodankfds Lv 1 4 pts. 9,576
  7. Avatar for ProfVince 37. ProfVince Lv 1 4 pts. 9,543
  8. Avatar for AlphaFold2 38. AlphaFold2 Lv 1 3 pts. 9,528
  9. Avatar for Apothecary1815 39. Apothecary1815 Lv 1 3 pts. 9,504
  10. Avatar for Zhang Ruichong 40. Zhang Ruichong Lv 1 3 pts. 9,495

Comments