Icon representing a puzzle

2686: Revisiting Puzzle 59: TCR Binding Protein

Closed since 4 months ago

Novice Overall Prediction

Summary


Created
November 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 10,201
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,153
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,078
  4. Avatar for Contenders 4. Contenders 27 pts. 10,078
  5. Avatar for VeFold 5. VeFold 16 pts. 9,920
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,893
  7. Avatar for Australia 7. Australia 5 pts. 9,889
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 9,882
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,815
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,752

  1. Avatar for pfirth 31. pfirth Lv 1 8 pts. 9,734
  2. Avatar for abiogenesis 32. abiogenesis Lv 1 7 pts. 9,710
  3. Avatar for orily1337 33. orily1337 Lv 1 6 pts. 9,693
  4. Avatar for carxo 34. carxo Lv 1 5 pts. 9,591
  5. Avatar for Moolanie 35. Moolanie Lv 1 5 pts. 9,578
  6. Avatar for Fasodankfds 36. Fasodankfds Lv 1 4 pts. 9,576
  7. Avatar for ProfVince 37. ProfVince Lv 1 4 pts. 9,543
  8. Avatar for AlphaFold2 38. AlphaFold2 Lv 1 3 pts. 9,528
  9. Avatar for Apothecary1815 39. Apothecary1815 Lv 1 3 pts. 9,504
  10. Avatar for Zhang Ruichong 40. Zhang Ruichong Lv 1 3 pts. 9,495

Comments