Icon representing a puzzle

2686: Revisiting Puzzle 59: TCR Binding Protein

Closed since 4 months ago

Novice Overall Prediction

Summary

Created
November 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,384
  2. Avatar for Team China 12. Team China 1 pt. 9,054
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,527
  4. Avatar for Bioqué? 14. Bioqué? 1 pt. 8,513
  1. Avatar for westchuck 41. westchuck Lv 1 2 pts. 9,491
  2. Avatar for Floddi 42. Floddi Lv 1 2 pts. 9,484
  3. Avatar for heather-1 43. heather-1 Lv 1 2 pts. 9,461
  4. Avatar for mammillaria 44. mammillaria Lv 1 2 pts. 9,429
  5. Avatar for jamiexq 45. jamiexq Lv 1 1 pt. 9,385
  6. Avatar for dahast.de 46. dahast.de Lv 1 1 pt. 9,384
  7. Avatar for Mohoernchen 47. Mohoernchen Lv 1 1 pt. 9,341
  8. Avatar for zbp 48. zbp Lv 1 1 pt. 9,338
  9. Avatar for Idiotboy 49. Idiotboy Lv 1 1 pt. 9,297
  10. Avatar for RichGuilmain 50. RichGuilmain Lv 1 1 pt. 9,276

Comments