Icon representing a puzzle

2686: Revisiting Puzzle 59: TCR Binding Protein

Closed since 4 months ago

Novice Overall Prediction

Summary

Created
November 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,201
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,153
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,078
  4. Avatar for Contenders 4. Contenders 27 pts. 10,078
  5. Avatar for VeFold 5. VeFold 16 pts. 9,920
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,893
  7. Avatar for Australia 7. Australia 5 pts. 9,889
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 9,882
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,815
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,752
  1. Avatar for westchuck 41. westchuck Lv 1 2 pts. 9,491
  2. Avatar for Floddi 42. Floddi Lv 1 2 pts. 9,484
  3. Avatar for heather-1 43. heather-1 Lv 1 2 pts. 9,461
  4. Avatar for mammillaria 44. mammillaria Lv 1 2 pts. 9,429
  5. Avatar for jamiexq 45. jamiexq Lv 1 1 pt. 9,385
  6. Avatar for dahast.de 46. dahast.de Lv 1 1 pt. 9,384
  7. Avatar for Mohoernchen 47. Mohoernchen Lv 1 1 pt. 9,341
  8. Avatar for zbp 48. zbp Lv 1 1 pt. 9,338
  9. Avatar for Idiotboy 49. Idiotboy Lv 1 1 pt. 9,297
  10. Avatar for RichGuilmain 50. RichGuilmain Lv 1 1 pt. 9,276

Comments