Icon representing a puzzle

2686: Revisiting Puzzle 59: TCR Binding Protein

Closed since 5 months ago

Novice Overall Prediction

Summary

Created
November 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,384
  2. Avatar for Team China 12. Team China 1 pt. 9,054
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,527
  4. Avatar for Bioqué? 14. Bioqué? 1 pt. 8,513
  1. Avatar for RWoodcock 61. RWoodcock Lv 1 1 pt. 8,568
  2. Avatar for Sammy3c2b1a0 62. Sammy3c2b1a0 Lv 1 1 pt. 8,527
  3. Avatar for Neckot 63. Neckot Lv 1 1 pt. 8,513
  4. Avatar for Matrena 64. Matrena Lv 1 1 pt. 8,473
  5. Avatar for meyarsn6 65. meyarsn6 Lv 1 1 pt. 7,872
  6. Avatar for danielaj 66. danielaj Lv 1 1 pt. 4,472
  7. Avatar for Mobilize3548 67. Mobilize3548 Lv 1 1 pt. 2,942
  8. Avatar for drumpeter18yrs9yrs 68. drumpeter18yrs9yrs Lv 1 1 pt. 2,942
  9. Avatar for Bletchley Park 69. Bletchley Park Lv 1 1 pt. 2,942
  10. Avatar for zakha04 70. zakha04 Lv 1 1 pt. 2,942

Comments