Icon representing a puzzle

2686: Revisiting Puzzle 59: TCR Binding Protein

Closed since 4 months ago

Novice Overall Prediction

Summary

Created
November 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,201
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,153
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,078
  4. Avatar for Contenders 4. Contenders 27 pts. 10,078
  5. Avatar for VeFold 5. VeFold 16 pts. 9,920
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,893
  7. Avatar for Australia 7. Australia 5 pts. 9,889
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 9,882
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,815
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,752
  1. Avatar for RWoodcock 61. RWoodcock Lv 1 1 pt. 8,568
  2. Avatar for Sammy3c2b1a0 62. Sammy3c2b1a0 Lv 1 1 pt. 8,527
  3. Avatar for Neckot 63. Neckot Lv 1 1 pt. 8,513
  4. Avatar for Matrena 64. Matrena Lv 1 1 pt. 8,473
  5. Avatar for meyarsn6 65. meyarsn6 Lv 1 1 pt. 7,872
  6. Avatar for danielaj 66. danielaj Lv 1 1 pt. 4,472
  7. Avatar for Mobilize3548 67. Mobilize3548 Lv 1 1 pt. 2,942
  8. Avatar for drumpeter18yrs9yrs 68. drumpeter18yrs9yrs Lv 1 1 pt. 2,942
  9. Avatar for Bletchley Park 69. Bletchley Park Lv 1 1 pt. 2,942
  10. Avatar for zakha04 70. zakha04 Lv 1 1 pt. 2,942

Comments