Placeholder image of a protein
Icon representing a puzzle

2693: Electron Density Reconstruction 146

Closed since 4 months ago

Novice Overall Prediction Electron Density

Summary


Created
November 18, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two identical chains here, and it's a bit big so the Trim tool is recommended.

Sequence
MLSTGTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPERLVQMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDSITAHYRAEENRSGLIAELSRQLQVLLWIARKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLERHRFRPEGLMAYFRITERGIEDVE

Top groups


  1. Avatar for CBE_ProEn_2025 11. CBE_ProEn_2025 1 pt. 28,619
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 13,146

  1. Avatar for dpmattingly 31. dpmattingly Lv 1 6 pts. 35,452
  2. Avatar for NinjaGreg 32. NinjaGreg Lv 1 6 pts. 35,287
  3. Avatar for TheGUmmer 33. TheGUmmer Lv 1 5 pts. 35,205
  4. Avatar for zxspectrum 34. zxspectrum Lv 1 4 pts. 34,789
  5. Avatar for Trajan464 35. Trajan464 Lv 1 4 pts. 34,436
  6. Avatar for alcor29 36. alcor29 Lv 1 3 pts. 34,328
  7. Avatar for toshiue 37. toshiue Lv 1 3 pts. 33,918
  8. Avatar for Idiotboy 38. Idiotboy Lv 1 3 pts. 33,832
  9. Avatar for carsonfb 39. carsonfb Lv 1 2 pts. 33,378
  10. Avatar for Dr.Sillem 40. Dr.Sillem Lv 1 2 pts. 33,181

Comments


LociOiling Lv 1

Since the PDB entry did not get cited above, a quick check shows this one is a match for 2CVF or 2CVH, both with the same authors.

The validation scores for 2CVF look worse….