Placeholder image of a protein
Icon representing a puzzle

2693: Electron Density Reconstruction 146

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary

Created
November 18, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two identical chains here, and it's a bit big so the Trim tool is recommended.

Sequence
MLSTGTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPERLVQMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDSITAHYRAEENRSGLIAELSRQLQVLLWIARKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLERHRFRPEGLMAYFRITERGIEDVE

Top groups

  1. Avatar for VeFold
    1. VeFold
    100 pts. 39,138
  2. Avatar for Contenders 2. Contenders 63 pts. 39,095
  3. Avatar for Go Science 3. Go Science 37 pts. 38,878
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 21 pts. 38,448
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 11 pts. 38,146
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 5 pts. 37,025
  7. Avatar for Australia 7. Australia 2 pts. 36,766
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 35,205
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 32,928
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 31,255
  1. Avatar for dpmattingly 31. dpmattingly Lv 1 6 pts. 35,452
  2. Avatar for NinjaGreg 32. NinjaGreg Lv 1 6 pts. 35,287
  3. Avatar for TheGUmmer 33. TheGUmmer Lv 1 5 pts. 35,205
  4. Avatar for zxspectrum 34. zxspectrum Lv 1 4 pts. 34,789
  5. Avatar for Trajan464 35. Trajan464 Lv 1 4 pts. 34,436
  6. Avatar for alcor29 36. alcor29 Lv 1 3 pts. 34,328
  7. Avatar for toshiue 37. toshiue Lv 1 3 pts. 33,918
  8. Avatar for Idiotboy 38. Idiotboy Lv 1 3 pts. 33,832
  9. Avatar for carsonfb 39. carsonfb Lv 1 2 pts. 33,378
  10. Avatar for Dr.Sillem 40. Dr.Sillem Lv 1 2 pts. 33,181

Comments

LociOiling Lv 1

Since the PDB entry did not get cited above, a quick check shows this one is a match for 2CVF or 2CVH, both with the same authors.

The validation scores for 2CVF look worse….