Placeholder image of a protein
Icon representing a puzzle

2693: Electron Density Reconstruction 146

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary

Created
November 18, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There are two identical chains here, and it's a bit big so the Trim tool is recommended.

Sequence
MLSTGTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLLSGKKVAYVDTEGGFSPERLVQMAETRGLNPEEALSRFILFTPSDFKEQRRVIGSLKKTVDSNFALVVVDSITAHYRAEENRSGLIAELSRQLQVLLWIARKHNIPVIVINQVHFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKPGLRVAVLERHRFRPEGLMAYFRITERGIEDVE

Top groups

  1. Avatar for VeFold
    1. VeFold
    100 pts. 39,138
  2. Avatar for Contenders 2. Contenders 63 pts. 39,095
  3. Avatar for Go Science 3. Go Science 37 pts. 38,878
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 21 pts. 38,448
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 11 pts. 38,146
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 5 pts. 37,025
  7. Avatar for Australia 7. Australia 2 pts. 36,766
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 35,205
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 32,928
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 31,255
  1. Avatar for SemperRabbit 11. SemperRabbit Lv 1 46 pts. 37,691
  2. Avatar for georg137 12. georg137 Lv 1 42 pts. 37,689
  3. Avatar for gmn 13. gmn Lv 1 39 pts. 37,689
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 36 pts. 37,686
  5. Avatar for grogar7 15. grogar7 Lv 1 33 pts. 37,646
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 30 pts. 37,357
  7. Avatar for nicobul 17. nicobul Lv 1 27 pts. 37,323
  8. Avatar for Bruno Kestemont 18. Bruno Kestemont Lv 1 25 pts. 37,305
  9. Avatar for silent gene 19. silent gene Lv 1 23 pts. 37,188
  10. Avatar for Elfi 20. Elfi Lv 1 20 pts. 37,142

Comments

LociOiling Lv 1

Since the PDB entry did not get cited above, a quick check shows this one is a match for 2CVF or 2CVH, both with the same authors.

The validation scores for 2CVF look worse….