Placeholder image of a protein
Icon representing a puzzle

2702: Electron Density Reconstruction 149

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary


Created
December 10, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has two identical chains, and comes from PDB entry 2F7K. It's large, so the trim tool is recommended.

Sequence
SYYHHHHHHHEGVRTMEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 71,270
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 67,472
  3. Avatar for CBE_ProEn_2025 13. CBE_ProEn_2025 1 pt. 67,149

  1. Avatar for bravosk8erboy 11. bravosk8erboy Lv 1 47 pts. 74,540
  2. Avatar for Elfi 12. Elfi Lv 1 44 pts. 74,402
  3. Avatar for Aarav_Awasthi 13. Aarav_Awasthi Lv 1 40 pts. 74,396
  4. Avatar for Bruno Kestemont 14. Bruno Kestemont Lv 1 37 pts. 74,365
  5. Avatar for akaaka 15. akaaka Lv 1 34 pts. 74,237
  6. Avatar for grogar7 16. grogar7 Lv 1 31 pts. 74,182
  7. Avatar for AlkiP0Ps 17. AlkiP0Ps Lv 1 28 pts. 74,100
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 26 pts. 73,972
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 24 pts. 73,883
  10. Avatar for georg137 20. georg137 Lv 1 22 pts. 73,877

Comments