Placeholder image of a protein
Icon representing a puzzle

2702: Electron Density Reconstruction 149

Closed since 3 months ago

Novice Overall Prediction Electron Density

Summary

Created
December 10, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle has two identical chains, and comes from PDB entry 2F7K. It's large, so the trim tool is recommended.

Sequence
SYYHHHHHHHEGVRTMEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 71,270
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 67,472
  3. Avatar for CBE_ProEn_2025 13. CBE_ProEn_2025 1 pt. 67,149
  1. Avatar for hada 41. hada Lv 1 2 pts. 71,380
  2. Avatar for Crabbex 42. Crabbex Lv 1 2 pts. 71,298
  3. Avatar for aendgraend 43. aendgraend Lv 1 2 pts. 71,270
  4. Avatar for Dr.Sillem 44. Dr.Sillem Lv 1 1 pt. 71,224
  5. Avatar for alcor29 45. alcor29 Lv 1 1 pt. 70,890
  6. Avatar for RichGuilmain 46. RichGuilmain Lv 1 1 pt. 70,862
  7. Avatar for zbp 47. zbp Lv 1 1 pt. 70,844
  8. Avatar for pfirth 48. pfirth Lv 1 1 pt. 70,322
  9. Avatar for abiogenesis 49. abiogenesis Lv 1 1 pt. 70,041
  10. Avatar for Steven Pletsch 50. Steven Pletsch Lv 1 1 pt. 69,909

Comments