Icon representing a puzzle

2701: Revisiting Puzzle 64: Thioredoxin

Closed since 3 months ago

Novice Overall Prediction

Summary

Created
December 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 11,333
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 11,188
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,861
  4. Avatar for Mahmut Oyunda 14. Mahmut Oyunda 1 pt. 10,846
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 10,807
  6. Avatar for Team China 16. Team China 1 pt. 10,785
  1. Avatar for Th1sN@me!sN0tAPun 41. Th1sN@me!sN0tAPun Lv 1 3 pts. 11,372
  2. Avatar for aendgraend 42. aendgraend Lv 1 3 pts. 11,333
  3. Avatar for hada 43. hada Lv 1 3 pts. 11,305
  4. Avatar for orily1337 44. orily1337 Lv 1 2 pts. 11,301
  5. Avatar for ProfVince 45. ProfVince Lv 1 2 pts. 11,289
  6. Avatar for heather-1 46. heather-1 Lv 1 2 pts. 11,281
  7. Avatar for abiogenesis 47. abiogenesis Lv 1 2 pts. 11,278
  8. Avatar for Trajan464 48. Trajan464 Lv 1 2 pts. 11,262
  9. Avatar for zbp 49. zbp Lv 1 1 pt. 11,255
  10. Avatar for Larini 50. Larini Lv 1 1 pt. 11,253

Comments