Icon representing a puzzle

2701: Revisiting Puzzle 64: Thioredoxin

Closed since 3 months ago

Novice Overall Prediction

Summary

Created
December 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 11,333
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 11,188
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,861
  4. Avatar for Mahmut Oyunda 14. Mahmut Oyunda 1 pt. 10,846
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 10,807
  6. Avatar for Team China 16. Team China 1 pt. 10,785
  1. Avatar for pfirth 51. pfirth Lv 1 1 pt. 11,192
  2. Avatar for rovergaard 52. rovergaard Lv 1 1 pt. 11,188
  3. Avatar for ZiiONIC 53. ZiiONIC Lv 1 1 pt. 11,111
  4. Avatar for Wildice1100 54. Wildice1100 Lv 1 1 pt. 11,069
  5. Avatar for drumpeter18yrs9yrs 55. drumpeter18yrs9yrs Lv 1 1 pt. 11,045
  6. Avatar for Flagg65a 56. Flagg65a Lv 1 1 pt. 10,993
  7. Avatar for p.naka 57. p.naka Lv 1 1 pt. 10,952
  8. Avatar for Mohoernchen 58. Mohoernchen Lv 1 1 pt. 10,944
  9. Avatar for Bletchley Park 59. Bletchley Park Lv 1 1 pt. 10,932
  10. Avatar for rinze 60. rinze Lv 1 1 pt. 10,909

Comments