Icon representing a puzzle

2701: Revisiting Puzzle 64: Thioredoxin

Closed since 3 months ago

Novice Overall Prediction

Summary

Created
December 17, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 11,333
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 11,188
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 10,861
  4. Avatar for Mahmut Oyunda 14. Mahmut Oyunda 1 pt. 10,846
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 10,807
  6. Avatar for Team China 16. Team China 1 pt. 10,785
  1. Avatar for DScott 61. DScott Lv 1 1 pt. 10,898
  2. Avatar for RWoodcock 62. RWoodcock Lv 1 1 pt. 10,863
  3. Avatar for Savas 63. Savas Lv 1 1 pt. 10,861
  4. Avatar for Shadowmaster_ 64. Shadowmaster_ Lv 1 1 pt. 10,847
  5. Avatar for fikret 65. fikret Lv 1 1 pt. 10,846
  6. Avatar for efull 66. efull Lv 1 1 pt. 10,842
  7. Avatar for s8b07ting@163.com 67. s8b07ting@163.com Lv 1 1 pt. 10,817
  8. Avatar for uni9999 68. uni9999 Lv 1 1 pt. 10,814
  9. Avatar for Sammy3c2b1a0 69. Sammy3c2b1a0 Lv 1 1 pt. 10,807
  10. Avatar for yuta329 70. yuta329 Lv 1 1 pt. 10,805

Comments